DPCstruct | MC22825
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 243 ± 30 aa |
| Standard deviation of domain lengths | 30.08 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 19.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W1V1H0 | 302-553 | ATGASSAPMLRRVWGLIGFTTNSQLVTFLSKANGLTIAANKIWILAKLILPDVIIKAAPSRGTANVFETTFHELAHASHFRQVGSGY… |
| A0A4Q8QGU5 | 32-279 | KFYALVHNAAYDFYDRAVRKFGIHHPNQSWLRISARYYGELADSRHNDLNINGGFAWVPLLGWKSEIQVGRLSQGKYEGSDKIYGIV… |
| A0A2T7BMA1 | 316-586 | None |
| A0A661YYY1 | 6-247 | None |
| A0A661Z462 | 314-586 | None |
| B0MZ52 | 5-238 | None |
| A0A7M4D5B0 | 2-214 | None |
| A0A7V3X8I6 | 162-430 | None |
| A0A1V5YN41 | 367-579 | None |
| A0A521AD85 | 24-226 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.