DPCstruct | MC22824
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 92 ± 8 aa |
| Standard deviation of domain lengths | 7.62 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 28.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16250 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A679HQT7 | 1-74 | MEVIEVSGGYGYQISHNNHITIFQPFIPSISGKKPFMEKRDAEQVGQLVMKRMKSGENYTVTLDDLESLGIKIK |
| A0A4Q8QAD7 | 44-131 | ILLFLHMTRHAPYEDGLRLEVKGSYNTGWQYVIYHHKKVLIYQKSIPVVAGSGAFVTKEDAQNIGNLVLAKIRKNELPVIQKTDLERF |
| A0A0Q5SX08 | 14-102 | None |
| A0A4Q2UUQ3 | 26-127 | None |
| A0A1H3XVD6 | 67-159 | None |
| A0A1F3S830 | 36-136 | None |
| A0A4U3L2E1 | 21-126 | None |
| A0A1M3FX34 | 18-108 | None |
| A0A3N7FHB4 | 98-197 | None |
| A0A3C1WKH7 | 48-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.