DPCstruct | MC22817
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 196 ± 24 aa |
| Standard deviation of domain lengths | 23.86 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 21.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0109 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P6RBX8 | 112-318 | SQSVECESVDINTLHEITRFFHQNYEIGQYAVAINVPEDQCKKGFKPSTFLREDRNVDVKNIISAHTNPVYEGRELIAAGVQTTPNP… |
| A0A4D9DJ07 | 131-337 | PETTGSINPAALKQIVDYVNDNGGVNKQYAFAASLPHDTCNNPQNVSTYLPMTQLKVMRETIRSFGALYNPPRGHIVAARPKEVITP… |
| A0A6J8APS1 | 6-203 | None |
| A0A6J8E1J6 | 24-219 | None |
| A0A8B6D4P4 | 35-225 | None |
| A0A6P8FP06 | 75-309 | None |
| A0A7J5YTB8 | 267-465 | None |
| A0A6A5FPJ2 | 26-217 | None |
| A0A1L8HMK1 | 1-180 | None |
| A0A498LYM0 | 648-868 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.