DPCstruct | MC22816
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 144 ± 11 aa |
| Standard deviation of domain lengths | 11.38 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 68.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 42.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4D9DFG0 | 1-153 | MNEEEAKGLVWKALEADRVIHTQQLGLPWVEPDDWFLDNVGPIVHRKAIKSASKLAQEVMALTESSQQEEEEEGAEGGRKEAAAEAG… |
| A0A822E4M8 | 1-138 | MEKFHELWIMNEERCKEMTQKLLDADRIIFEHQLGLTWTPPDLDFMNNIGPIDATKIPKPSIDVVREILTDQQEDSSTKQTTSHLSN… |
| A0A094ZE96 | 385-530 | None |
| A0A1Y1XI11 | 93-238 | None |
| A0A401NXU0 | 287-457 | None |
| A0A4X1TQ97 | 209-351 | None |
| A0A820L713 | 1-138 | None |
| A0A815FJR8 | 805-939 | None |
| A0A7J8E1A7 | 100-229 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.