DPCstruct | MC22813
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 171 ± 25 aa |
| Standard deviation of domain lengths | 24.88 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 31.61 |
| Pfam Score | 85.00 |
| Assigned Pfam label(s) | PF19293- PF02457 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R0XM77 | 4-131 | NTILIAILSSAGIIIILILLPYLIKFVQWAFKKNKYNTMGSSSQMRLIHQLYEATQELAATKTGAIITIVNKEKLDHLRTDGIVIDA… |
| A0A3D1ND31 | 4-151 | IKGTRAVSVVYGLVLVVALYFAAGKLGLYTLHWLLGNFLGSLFLVVIILFRRDIRKALAVMGATTIFRREAMEESCMDELILALVAM… |
| A0A7C3TM06 | 259-439 | None |
| A0A1I0M9Z6 | 40-223 | None |
| A0A2A5DSQ7 | 17-206 | None |
| A0A2V9ZTY0 | 5-210 | None |
| A0A139PQ75 | 3-156 | None |
| A0A1L4D2G3 | 11-197 | None |
| A0A317HN87 | 173-343 | None |
| A0A7X6TP29 | 19-192 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.