DPCstruct | MC22812
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 85 ± 14 aa |
| Standard deviation of domain lengths | 13.77 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 72.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 27.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D1NC47 | 1-73 | MQVKTYVGRSATEVMGRIKAELGTDAIILGTKTVTKDDGSWVEIMAARETPLPPSPPQGPAAEPADPLAPTAA |
| A0A7X6WK68 | 1-65 | MQVKRFVANTLQEAILKVKKEMGKNAVILHTRKFKEGGFFGFFSKEMVEVTAAIDNSPLTVIEPP |
| A0A7Z1ADM2 | 1-80 | None |
| A0A7C1A4Z0 | 1-101 | None |
| A0A238D819 | 1-82 | None |
| A0A1V4RI54 | 1-82 | None |
| D6PKY5 | 1-75 | None |
| A0A6N1YBY8 | 1-118 | None |
| A0A660X4G9 | 1-92 | None |
| A0A0A2SRG5 | 1-64 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.