DPCstruct | MC22810
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 158 ± 33 aa |
| Standard deviation of domain lengths | 33.08 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 71.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 29.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A524PS40 | 46-192 | KVPRETILQLDEEAVAEEDETGEMPEEPLPGFDTSLLDLDYSVQDWLTATPEPVREPEKKSEAELVNSFLASNPRIGPVKELTEGTS… |
| A0A090W060 | 8-134 | THSFNEWLKLTRLKPIKRPEDLDEKDSDPKVNSLTSNASENTTHFEIIDKFIAENPKITPSKTNAPKGNLAKVRTAQPEALMTETLA… |
| A0A840EQ66 | 121-266 | None |
| A0A7Z0G785 | 543-691 | None |
| A0A223P1Q7 | 418-653 | None |
| A0A7C1DZD2 | 92-234 | None |
| A0A3E1NJG0 | 328-556 | None |
| A0A0U3K149 | 72-286 | None |
| A0A0M3C9Q4 | 26-224 | None |
| A0A380C2F2 | 181-377 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.