DPCstruct | MC2281
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 111 ± 17 aa |
| Standard deviation of domain lengths | 16.59 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.88 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 38.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15657 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A085AAB8 | 200-283 | SPEGSARSGAFNEAKRQSGIPVSQSPSKVYPNVDKRNNPQPGYIYEFDVPRPGGGTQKVYIRDDAGGHFFTDDPSQNRGPHFND |
| A0A0K1F2A0 | 8-109 | SRRAAFRQAKRDLGIPVSRQPDKVHKVIKDIHGKVIPGGRGYQFNTGVIIGENGSPKALHRDIFDHPNGHVFPDGGRVGPHFNTQVV… |
| A0A7Y0A0H4 | 1-98 | None |
| W4VDQ5 | 68-178 | None |
| A0A8A8G1W0 | 58-179 | None |
| A0A2W2B3F0 | 1-98 | None |
| A0A329VZ57 | 112-210 | None |
| A0A7Y7WL04 | 33-150 | None |
| A0A7X8L4K7 | 7-121 | None |
| A0A4R6JZ98 | 446-578 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.