DPCstruct | MC22809
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 118 ± 13 aa |
| Standard deviation of domain lengths | 13.28 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 27.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V9CL79 | 90-195 | MHMPERWGYVQFTDVPAGSRAVAFVENRNERVTWALRRLYHRQRAFRAAHGRYASDLAALSAGNIQVDGLQFRPTLTATDSLYEISA… |
| A0A524PDU2 | 1-105 | MHYPEMWGYLQFSDIIAGEGKASFVPDPDSGLKWELRTLYYAQRAYATANGHFSNDPEILKSLGFESSMTLPEIILTHSGYEASALS… |
| A0A3R7Y567 | 22-124 | None |
| A0A2D8GCS3 | 199-313 | None |
| A0A2V2S3X2 | 233-372 | None |
| A0A836QHZ6 | 34-144 | None |
| A0A418B6V5 | 476-575 | None |
| A0A7Y2YV91 | 12-130 | None |
| W4HA51 | 230-361 | None |
| A0A812D371 | 144-269 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.