DPCstruct | MC22802
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 366 ± 43 aa |
| Standard deviation of domain lengths | 43.46 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 33.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y9YGN6 | 353-640 | HLDFPKRAPAPPLSPITLPPSLVQRKRVQQWAIILSGLSDAERRQCVVVSRMFRYAVYLSAFHVLKRQHDGRRFSQDVSQYSQAMTN… |
| A0A550CGQ6 | 3-379 | TTHQSISMPPSRANRKRVPSWAVILSAVEPTELRNCALVSRMFRYAVYLSAGVRLERYFRGGRLDRDTKHTSMNMANMWPYLLARER… |
| A0A0W4ZV79 | 233-665 | None |
| A0A5N5QTH3 | 264-678 | None |
| A0A284RF37 | 455-769 | None |
| A0A401H419 | 5-343 | None |
| A0A0C2Y0F7 | 33-437 | None |
| A0A0C9WFT2 | 666-1060 | None |
| A0A5M6BUK3 | 50-419 | None |
| W4K7S2 | 270-575 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.