DPCstruct | MC22800
Metacluster Properties and Pfam Annotations
| Number of structural domains | 61 |
|---|---|
| Mean domain length (aa) | 406 ± 106 aa |
| Standard deviation of domain lengths | 105.97 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 71.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 21.08 |
| Pfam Score | 77.82 |
| Assigned Pfam label(s) | PF01253- PF21023- CL0668 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A550CGA3 | 96-469 | ISGRWAPNLTRRRPRWLRRGGRRSGRRGHLFPVSSNAFYTAHVLPCRPAFPDLVLPPSGDPSNAGPRDISIKTSTHKSLVAFLKAAE… |
| A0A7J7SQK5 | 2-248 | QQEQIIQVKELSKGVESIVAVDWKHPRITSFVIPEPSPTSQTIQEGSREQPYHPPDIKPLYCVPASMSLLFQESGHKKGSILEGGEV… |
| A0A4U5M3T2 | 28-337 | None |
| A0A0F7SGV7 | 356-839 | None |
| A0A812MBX7 | 88-536 | None |
| A0A139Y3U7 | 14-280 | None |
| A0A0F4Z0C3 | 63-647 | None |
| A0A4C1ZU97 | 33-561 | None |
| A0A4R0RAQ1 | 451-944 | None |
| A0A1Q8S3B1 | 1-217 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.