DPCstruct | MC2280
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 85 ± 9 aa |
| Standard deviation of domain lengths | 8.98 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 25.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A843ZP74 | 1-89 | MSYSLLSRMQTVARKEHQCIWCCCPVLTGSHYVRENSTYDGHFQNFAWHEACRKDADQYFDESGAEEFTSGNDMPFHALYQLEVGAH… |
| A0A0K1F293 | 1-83 | MTELRVREVRGSRKAHVCDWCLRRIEPGEPYRYSFIVDGGDSYPWHECRDCTPYVQELCAEDPQHAQDLGYTTSEYMEWMEER |
| A0A6C0U4R8 | 12-89 | None |
| A0A158RYD0 | 42-126 | None |
| A0A1H3KR58 | 17-104 | None |
| A0A7I7A8N7 | 1-101 | None |
| A0A4R5K5D7 | 4-100 | None |
| R7ZCR4 | 3-80 | None |
| A0A1I6EC20 | 9-95 | None |
| A0A1E7HYZ8 | 12-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.