DPCstruct | MC22798
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 147 ± 47 aa |
| Standard deviation of domain lengths | 46.64 |
| Length coefficient of variation | 0.32 |
| Mean AlphaFold2 pLDDT confidence score | 79.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 16.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y9ZIF4 | 113-328 | YPDVQVKDDLHLYWLALGGLEKKPFKTVEQTTEESARRWMQSNKSYRTLDEARQAVIKFRIGKLNSPATVIGVKPDVDEIDDVHYAP… |
| A0A550CCH0 | 96-229 | RQLDEALATADFIVGLPDPQDPTIQRVELPGLKFHMRFWMGYQKIYISFDFCDNESQAPIAKPKDLTVWELVLGVLGGRAIQLQSQE… |
| A0A1Y2J3R3 | 61-266 | None |
| A0A1J8QHA3 | 33-219 | None |
| A0A369J2F2 | 39-175 | None |
| A0A4Q9NL50 | 7-184 | None |
| A0A2H3CSC1 | 53-215 | None |
| A0A2I1E4J0 | 19-123 | None |
| U9U8V2 | 3-115 | None |
| A0A2I1FCK5 | 3-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.