DPCstruct | MC22793
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 139 ± 17 aa |
| Standard deviation of domain lengths | 16.86 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 32.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U5VQE3 | 1-132 | MGDRFVISCAPRDVRVVRVMRREVFVAWPWGTPDPTSRYRWDGDVSVPIDTAHPDWSQTPWRLEPRTGLSAGDRVQLSIPPTEVVVQ… |
| W9DZA7 | 16-155 | VGDIVRLSAEPVEVVVSRVTVRTVFVEWPWRTVDPGHHWDGRMGFPRDPDHHDWRGTPWRMEPDGRGLSARDVCIVGVPETFARVEL… |
| A0A366M1Y3 | 2-116 | None |
| A0A3N1KUT1 | 23-155 | None |
| A0A562W8Y0 | 9-122 | None |
| A0A2T0JXF0 | 3-150 | None |
| A0A386ZC34 | 5-154 | None |
| U5VY06 | 1-169 | None |
| A0A540QCA3 | 58-209 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.