DPCstruct | MC22792
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 209 ± 30 aa |
| Standard deviation of domain lengths | 30.49 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 23.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0260 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A536UVW1 | 2-239 | SARPLYRWHEPAFRTQYAELKERTAAAGQLLPGTTGTLTKRSPNPGGQEYWYRVYYNVPGRQSEQFVGSVHEEGAYAAMRERMALAD… |
| A0A238YHH2 | 2-184 | AFEQRDGTDYLYRRIGSVGKSLGPRSVDSEQMLYRFKASRDQNKTRLQKLSENLNTQAAILRSLGAGRMPIIPARILRELRIHGRQT… |
| A0A2T5XAS1 | 3-226 | None |
| A0A4D7WUR7 | 1-224 | None |
| A0A6N1X9Q3 | 24-236 | None |
| A0A258GQL0 | 1-219 | None |
| A0A7W5TRA1 | 40-280 | None |
| A0A7C1MC05 | 3-210 | None |
| A0A2H0J5W9 | 4-215 | None |
| A0A534D8C6 | 38-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.