DPCstruct | MC22787
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 76 ± 8 aa |
| Standard deviation of domain lengths | 7.80 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 54.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00122 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A822H3U6 | 1-72 | MAKKNAIVRSLLSVEILACTSVICSDQTGTLTTNQMSVCRTFIFNKAESNDIQIDQFEVTGSTYEPKGDIMF |
| A0A0D3A0S1 | 1-68 | MAQKNALVRKLPSVETLGCTTVICSDKTGTLTTNQMAVSKLVAMGSRVGTLRSFNVEGTSFDPRDGKI |
| A0A1Q9D6M6 | 571-650 | None |
| A0A0L7BXM8 | 119-181 | None |
| A0A0B1PMI7 | 192-267 | None |
| A0A453HAQ9 | 63-147 | None |
| A0A446RT87 | 1-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.