DPCstruct | MC22786
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 139 ± 11 aa |
| Standard deviation of domain lengths | 10.69 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 30.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K0FY18 | 1-145 | MSTLEPKSLNEKIICLRKVIKKSKVHLFRHHVRAIAKLKKSNNPGNAGKIERLEEEMNAIKNIKPDSLSKFALVNTKTKDELLTNLK… |
| A0A6J1TNG2 | 1-145 | MLNKTDVSDQITGLRPKVRQAAVHLAHHLTKEIKKCQGRKGPKAEKFHKKAETYRKEVLLLKKIKEDSVSRYALRMDFSEREKLLGD… |
| A0A833VQV1 | 3-122 | None |
| A0A0R3RJD0 | 591-720 | None |
| Q6DI30 | 7-141 | None |
| A0A6J8DN24 | 25-175 | None |
| A0A1Y3EHB9 | 3-145 | None |
| A0A0N4UD05 | 1-159 | None |
| A0A151M7Z4 | 1-133 | None |
| A0A7M3QCV4 | 711-861 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.