DPCstruct | MC22785
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 78 ± 3 aa |
| Standard deviation of domain lengths | 3.32 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 89.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 49.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0179 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0V0Y732 | 1-82 | MMLIDNENEVFMIDRKNNIFSVPGLSFFLPDLSASPKQTLVDGELVLDRLNGVIYPRYLIYDVMAINGTSVVNLSYYDRERI |
| A0A0K0FRS2 | 1-79 | MVSWKDDGVRYLVLIKDEIYAFDRNNNVFKINNMYLFHRKELRHIRDTLVDTEIIMEKTPISGGEFRTIPRMLKYDVVH |
| A0A815VU26 | 316-392 | None |
| A0A820RPH1 | 1-82 | None |
| A0A7R9CU32 | 140-214 | None |
| A0A4Z2GFT9 | 218-294 | None |
| A0A0K2UM70 | 284-359 | None |
| A0A0M3K3R0 | 198-282 | None |
| Q7Q9N3 | 316-391 | None |
| A0A2A2JZJ2 | 314-387 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.