DPCstruct | MC22784
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 70 ± 5 aa |
| Standard deviation of domain lengths | 4.94 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 92.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 36.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A645C8V9 | 1-67 | MRPEHRRVSEMVIECGHAVPLDEETKKKREELGLDPIPETVQKYPEALEELKTLLKTCKFDKLVAEK |
| A0A1Q9P824 | 1-79 | MAVKEGFMLPQHKKASQKLLATGHAVPIDDANREIRKDLGLEELPPTTHSNKKALNQVQEIMKRTGFKELIESENKEGE |
| A0A1Q9N1U1 | 1-71 | None |
| A0A842YFM2 | 2-62 | None |
| A0A497MR45 | 117-180 | None |
| A0A7J4FC55 | 14-85 | None |
| A0A843FSJ4 | 229-298 | None |
| A0A109UV43 | 242-311 | None |
| A0A847SX02 | 74-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.