DPCstruct | MC22783
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 82 ± 5 aa |
| Standard deviation of domain lengths | 4.92 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 84.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 33.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0H3LTJ3 | 18-98 | GAGKGGGLARLAGMLCQQALFQRWVSVVAGPAPQGVSAQDHAAEFVRLRCRVDTRAQLDHDARAAWRFHQWVRRPYRMWAE |
| A0A5E4Y0R6 | 1-86 | MKGLAQLAGIWCSSPDFHQWLFELGGLPANEDDAIEFVYLACEINSRSELDSNERAARLFVEKVRRPFREWLNGRPAAAPSRQRNK |
| A0A1Q9AN22 | 208-283 | None |
| A0A0F5JV59 | 1-82 | None |
| V2GKZ1 | 1-87 | None |
| A0A7R7TB41 | 1-76 | None |
| A0A4P7LIS7 | 33-124 | None |
| A0A838B5N0 | 86-163 | None |
| A0A3Q8XQ58 | 128-206 | None |
| A0A503P9T7 | 67-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.