DPCstruct | MC22782
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 181 ± 18 aa |
| Standard deviation of domain lengths | 18.44 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 16.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F4L801 | 4-177 | TIQDLAHIQKLNNRFINQIQAHPSKTYSVRIGWPGGTRTCTVNYFPNYHFWMFSEINHDHPSRPKYLHALCSAEPHQNQAVSAPCQI… |
| A0A5E4U746 | 4-184 | AFEVVTDIADISRLNEQLAKQLRATLQYKESREISYPAGHHTGTVYFEARAGTSVRAWSPHVAPDKLLNLVLFAEPGSPKWIEIAVQ… |
| A0A166CPP2 | 1-196 | None |
| A0A661ZDV9 | 1-136 | None |
| A0A0Q9EWY6 | 41-215 | None |
| A0A2D5FE17 | 4-188 | None |
| A0A1I4E3R6 | 9-174 | None |
| A0A806LWT2 | 2-168 | None |
| A0A2H1FIN8 | 5-191 | None |
| A0A6N6MFN1 | 4-231 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.