DPCstruct | MC22781
Metacluster Properties and Pfam Annotations
| Number of structural domains | 67 |
|---|---|
| Mean domain length (aa) | 144 ± 16 aa |
| Standard deviation of domain lengths | 15.93 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 27.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C6WFV8 | 129-282 | TNIDKLINAEKKISELEKIKKDQTAAKKVQNLIINLPAIDEVTLDDATNIENVRSEYNSLTAEQKEYVTNLKVLEEVEVKLASLKAA… |
| A0A6N9QGV4 | 77-245 | LTVKKAAVETPDPADVSAAEAVEKLINDLPAADDITLENKADVEAARAAYEKLNGVAKALVSEDAVAKLEAAEKQIADLEKAENDAA… |
| A0A0G9L908 | 425-577 | None |
| A0A1C5VLI0 | 47-189 | None |
| A0A5J6SJN7 | 268-413 | None |
| A0A2Z4ICK8 | 118-255 | None |
| A0A0D0S8C7 | 791-932 | None |
| A0A7C6U3G8 | 269-390 | None |
| A0A396QTI7 | 283-431 | None |
| A0A396QGE8 | 439-586 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.