DPCstruct | MC22780
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 850 ± 96 aa |
| Standard deviation of domain lengths | 96.40 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 18.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D5ZQW2 | 1-1010 | MRNLHLTFSHPWLLLLLLPAIAFTLIPYFRLAKRYRRTRSRITSMVLHMIVMVMAVLTLSGLNFRYEKVNKNNEIILLVDVSATEND… |
| A0A1Q3SG79 | 1-877 | MPFSFSFGYIDALWLLLLLPVVVVLARKGGSGAVLRKSSRRLSIAIRLLIVTLLVLSIAQLQFVTTSDRLSTVFLMDVSDSVGADGK… |
| A0A2N1S937 | 64-704 | None |
| A0A354GND6 | 127-1076 | None |
| A0A7X7L1A7 | 1-857 | None |
| A0A2F0AQK1 | 437-1214 | None |
| A0A1I5KNL6 | 13-888 | None |
| A0A7C3INW0 | 393-1253 | None |
| A0A3D4MMT4 | 1-881 | None |
| A0A357XWE1 | 3-775 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.