DPCstruct | MC22779
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 98 ± 7 aa |
| Standard deviation of domain lengths | 7.06 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 28.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A174TX13 | 7-109 | QNAGDDFFLNQRGAKVFYDESRQPLLPIAKGKNVYKVLSIGFGNTGTPMVTIESGRETVCYKLPYEYSEWAMTVVECANMGEKLVPG… |
| A0A3D5ZLZ5 | 99-190 | DYTRQGYLDIPKLKSNKERGAIYQVLSVGFFGGNEQPCVTIYKDEQAQCLLLPKELSDWAFDMVAFSNIGGNFFPSDVEFGYINGRY… |
| A0A2X4YHW2 | 219-316 | None |
| A0A243BMC8 | 17-124 | None |
| A0A1A0JRH7 | 4-93 | None |
| A0A1S2NTP5 | 29-126 | None |
| A0A285GFY1 | 2-90 | None |
| A0A2C1BQ66 | 7-99 | None |
| A0A353YX98 | 10-119 | None |
| A0A1L5LKE3 | 407-505 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.