DPCstruct | MC22778
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 63 ± 7 aa |
| Standard deviation of domain lengths | 6.56 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 91.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 42.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A174HNP4 | 1-52 | MNLMPLIPQADFRGYEPPSRALLEALRARARVHIPQFTHCRQCRADAVGVPG |
| A0A520KS25 | 35-98 | GIYMQNLIPLIPQYKFEEIEPPTPEDVEKKQEELGEVLKQMTHCRRCRADAIGRLEHDVQDKIQ |
| A0A1V5AM82 | 1-69 | None |
| A0A6M1HUJ2 | 22-90 | None |
| D9TS57 | 291-348 | None |
| A0A7H4MNI9 | 123-191 | None |
| A0A842TN74 | 116-174 | None |
| A0A1S8S6R0 | 15-81 | None |
| A0A1L8CZL6 | 156-210 | None |
| A0A4Q2WJS5 | 28-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.