DPCstruct | MC22777
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 113 ± 10 aa |
| Standard deviation of domain lengths | 10.43 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 31.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0264 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K3KZE4 | 1-104 | MAQRTFSVFGDSISTFEGVTSPANRIYYAGDLRRSTGVLEPEDTWWARVIAHFDGRLVSNAAFSGSMVDGAGFPAGHTPERIAEIAG… |
| A0A373KZR9 | 21-131 | EETEDGIRVSFFGDSITTYKDYSGTQGYYYDESMLPVESTWWMRLLGEEQWILGVNESIGGTRVTWDGVTEDEKQFIGNEWYLGLEE… |
| A0A3D3YK17 | 960-1072 | None |
| A0A1Q9JCQ8 | 66-180 | None |
| A0A810PYU0 | 295-416 | None |
| A0A1G9EUD0 | 17-125 | None |
| A0A7X7BZ97 | 67-171 | None |
| A0A6I2NIH9 | 945-1044 | None |
| R5FTI5 | 641-737 | None |
| A0A354UPF0 | 898-1017 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.