DPCstruct | MC22776
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 94 ± 13 aa |
| Standard deviation of domain lengths | 13.09 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 77.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 27.92 |
| Pfam Score | 42.86 |
| Assigned Pfam label(s) | PF00086- CL0547 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9E5U5 | 360-443 | ALGVVCTPNFCDSVRCQNVDLETCHGEYQPNGGTCGCCSICIKILREGNTCPGIPLRGGPPPIEKCDKGLDCKKDVYGTYKCTR |
| A0A4Q8K7D6 | 11-108 | MAIAAMALASRPSSYARHCGRDCDLDLCKRIRCRGIEEAECKGKIRQGGGFCRCCQNCIIPIPKGLPCNPDPGYGIPEPVAYCDEGL… |
| A0A0C9SDC8 | 19-106 | None |
| A0A067RGE8 | 21-111 | None |
| A0A2P8Y9H5 | 3-107 | None |
| A0A2P8Y9S2 | 80-182 | None |
| A0A4Y2LWU1 | 37-131 | None |
| A0A6P7FSJ2 | 5-98 | None |
| T1JF69 | 10-108 | None |
| A0A194AKI3 | 12-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.