DPCstruct | MC22774
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 66 ± 3 aa |
| Standard deviation of domain lengths | 3.00 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 91.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 37.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C1Z8W0 | 250-315 | LEERALAFRAAVSEGDDSHCGLVVEVRDKVVKVQTQMGEHWLKRSQLYPPKTKPCNFLNGVYQTPR |
| A0A419RTN2 | 43-107 | RRELAQFQSDLTVGDETNCGLVIEIRGPLAEIAVPVNRHAPSGAGTFWSRIDRLAPPYTSVCSFG |
| A0A0W1D3W8 | 156-221 | None |
| A0A7Y4SAU1 | 252-321 | None |
| A0A2G2L7N0 | 7-66 | None |
| A0A6L8LKG2 | 106-174 | None |
| A0A2T7V1A9 | 190-254 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.