DPCstruct | MC22772
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 166 ± 25 aa |
| Standard deviation of domain lengths | 25.06 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 77.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 18.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF17231 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A645EQ34 | 2-147 | ALPLPKNPTLFELQKPEPVQRFGVITEMEESRLPPSFELLAAFGAMGAAGIALILFARLFTRRLTPQEEERTAREKLKRKYGGRMIR… |
| A0A6J6NP79 | 2-134 | RRVIRPTLTGSIPTTIRNHISIARYAFPVLHLRLLGIALLAAAGFLAIFHGKLRRDNALHPIEERVAAHLGLVVVPVDALALPAGAA… |
| A0A7M1UUN6 | 186-346 | None |
| V4XZY2 | 42-233 | None |
| U1NV93 | 255-375 | None |
| A0A2B7GXL0 | 1-155 | None |
| R5YJH0 | 18-188 | None |
| A0A0N8PR89 | 122-306 | None |
| A0A2H5YHV4 | 311-473 | None |
| F1TA67 | 175-339 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.