DPCstruct | MC22770
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 232 ± 19 aa |
| Standard deviation of domain lengths | 19.14 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 90.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 24.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01955 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A645EMA0 | 80-279 | EYVYIPGTINIILHISAALTPGAMTRALITCTEAKTAALQELLAPSCYSSGIATGSGTDGCIIVSDLTSPVKLTDAGKHNKLGELIG… |
| A0A7X2P6Z5 | 211-447 | GTINIILMVNQRMTDAAMLRALVLCSEAKAAAVQELLLGSCYSHEIATGSGTDGTIIAAPMESEYLLTTASGHVKLGELIGKTVKKA… |
| A0A3R6YJE9 | 3-233 | None |
| H1D501 | 1-234 | None |
| A0A0U1L404 | 151-390 | None |
| A0A7C5U9B1 | 88-368 | None |
| A0A843DVK3 | 26-256 | None |
| A0A1E7IFL7 | 149-373 | None |
| A0A7C5RLA4 | 120-355 | None |
| A0A843CZB0 | 1-211 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.