DPCstruct | MC22769
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 215 ± 36 aa |
| Standard deviation of domain lengths | 36.31 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 85.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 30.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N5M186 | 245-421 | TFRTNVYVGSMSVPGFTGSLAMKAFDIIRVKPDDTWQLLVGDREPTIPVTEGAVRRPLTGLPSGFGMPTNLYCWQMEVYDGYLYVGS… |
| A0A645ELL6 | 1-234 | MGVFKNRLYVSGTKELPLAWAIPRGCDIVRIDEYDNYEVVVGPNSVSGILSGFYNPFNVYAWQIQEYENKLFVSTFDDSTNMQLILE… |
| A0A1Q7HWJ1 | 299-488 | None |
| A0A7X9AGY3 | 1-183 | None |
| T0CLP4 | 1-228 | None |
| A0A7W0ELP3 | 257-509 | None |
| A0A7V2MV97 | 282-492 | None |
| A0A7X6ZEN3 | 1-288 | None |
| A0A7X9S4I3 | 133-373 | None |
| I4EMB0 | 1-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.