DPCstruct | MC22765
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 168 ± 15 aa |
| Standard deviation of domain lengths | 15.37 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 27.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14266 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5GK19 | 444-606 | FRNGRLQKQKIKEHPVYQYSFLRESVQEHILEKLQYLIDQRLIKGTFENGTEYTIVATVLNLEKNIVRLIQKFDFTKKNPKLIFIMT… |
| A0A5S9M185 | 1-149 | MAVFSHLYEGTQRAIAEAISRICQHPKLLKKEGNETELDVRIYLFKQVLHLSQDLIELIQTFDYAQTVPKVILYHTEYNGELTRSDA… |
| Q97J76 | 656-824 | None |
| Q97EW3 | 131-323 | None |
| A0A1S9CSP9 | 83-223 | None |
| Q3EJE0 | 229-402 | None |
| A0A841KYK8 | 119-280 | None |
| A0A1I3T5M6 | 351-516 | None |
| A0A0F2JCR6 | 32-203 | None |
| A0A3B9SI68 | 697-887 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.