DPCstruct | MC22763
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 255 ± 24 aa |
| Standard deviation of domain lengths | 23.86 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 20.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19681 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E8LHN0 | 82-328 | FGLAPLAEVAASAHHWADLAPHLPDGPLRATVAHERVARGEDLSDVDLVDDPLGLPMRLGAWEPACDGPAIGPYAVDDPVPPTGRLE… |
| A0A6J6CS70 | 16-258 | VSEILAVHHSWQDLSTLLEPGHDRGVFAYERALRGDIINSDEPEILDIPITPQPWEPTYRYVSYNDDGVVEEFPTSPLWNESVLVSG… |
| F4L5Z5 | 91-367 | None |
| A0A800DL78 | 4-218 | None |
| A0A6L9IMK0 | 269-543 | None |
| A0A197SVJ9 | 64-341 | None |
| U5ELS8 | 1-214 | None |
| A0A1I2X0M5 | 1-258 | None |
| A0A191V502 | 1-283 | None |
| A0A4R6P669 | 36-290 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.