DPCstruct | MC22762
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 67 ± 13 aa |
| Standard deviation of domain lengths | 13.21 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 78.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 42.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11238 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V1U5J1 | 1-54 | RFAHYVEKRKLTQAYVLGTPVIALCGKVWVPSRDPERFPICPECKRLYELGPEG |
| A0A6J6CHH7 | 6-69 | KEQVDQVEAGDHERYSHFVKKDKIVESAVMGNAVVALCGKVWVPSRDPERFPVCPMCLKIYEKL |
| A0A0L0KRI2 | 4-75 | None |
| U7UXX6 | 69-139 | None |
| A0A357ZYG7 | 34-108 | None |
| A0A6L6CRE7 | 1-58 | None |
| A0A6G7XJX7 | 12-73 | None |
| A0A538LZ86 | 5-60 | None |
| A0A1E3RYC0 | 12-78 | None |
| A0A365PBL4 | 91-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.