DPCstruct | MC2276
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 120 ± 11 aa |
| Standard deviation of domain lengths | 11.49 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 26.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF21746 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R6UP56 | 22-139 | DFVAAYVRSLYAASVAERFDTQDSWASDAVTLIAFDDPQKLISIVLRVLDTDPPDEILPVLAAGPLEDYLCHCGIDAIENLERLVEN… |
| A0A6M8BLB2 | 2-122 | KSNEIQHWAQTYIEAQKRQITNTEDPLWWAIDLFFELMESKPEACWEVLLEISRRNPPEGVISIAGAGPLEDLIDSHGNRFIDQIEV… |
| A0A4Z0BPB7 | 79-182 | None |
| A0A1H4A4H6 | 3-112 | None |
| A0A2E2QLS9 | 110-225 | None |
| B9XLL4 | 14-125 | None |
| A0A5C7XK07 | 7-147 | None |
| A0A256WWW2 | 69-172 | None |
| A0A1E5XXI3 | 157-284 | None |
| A0A1E3W7Z7 | 121-237 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.