DPCstruct | MC22759
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 207 ± 29 aa |
| Standard deviation of domain lengths | 29.12 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 76.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 33.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S2J2N3 | 10-210 | LLKDSTRLAAFLQECLALGSLRGFKYFESFVRGREELVLCIYTNSYTPKPSVIMPKDVLNAYYPRNKVSQWQSPGSQSPLDEDFRQT… |
| A0A7R9YZ10 | 2-197 | RFGNLKCFMNYHLYMKGREELVVTVFSGAEGGMLHQSKGSSIFRAIEGNNNDLPPASPAAHELDVHNPEVTVFLIGAYAKYNWPYVW… |
| V9L3X5 | 25-273 | None |
| A0A6F9CRS7 | 24-182 | None |
| A0A087Y2Y4 | 1-241 | None |
| A0A2G9SKH1 | 21-235 | None |
| L1IFM8 | 44-270 | None |
| A0A0L0T5R8 | 75-302 | None |
| A0A672JZH8 | 2-176 | None |
| A0A388KZX9 | 69-283 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.