DPCstruct | MC22758
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 433 ± 60 aa |
| Standard deviation of domain lengths | 59.64 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 23.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A417Y7D2 | 2-416 | NTLLLAALPTAARPTIPSTTADHQGMVEVMAWDDLRGGFNFYRTMPGTTAWVFAGNSRHALVGASRNHGPFESHRNGHFLFKEFKSP… |
| I4Z4L1 | 144-536 | FLQVLGWDAAAGAFQFYERRNGSWFWAGSSWDSLEEDMRGKGPFDSHVNGSMVMKELRAPWLHWSSQSHTIPAETMAPDDPLAADPF… |
| A0A7V9L1M7 | 116-544 | None |
| A0A2Z6RDG1 | 334-741 | None |
| A0A175WG83 | 340-853 | None |
| Q2GTT9 | 6-576 | None |
| A0A3N4KAU4 | 128-570 | None |
| A0A849U1N7 | 222-635 | None |
| A0A0L1J757 | 3-417 | None |
| A0A835Z2T7 | 897-1235 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.