DPCstruct | MC22757
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 69 ± 2 aa |
| Standard deviation of domain lengths | 1.52 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 91.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 45.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J4XE98 | 3-69 | SISIDLETRSSVDIGKSGVYRYAEAEDFAILLFGYSVDGGTVQVIDLVGGEQIPQEILDALTDECII |
| W4UCU7 | 1-70 | MRQIAIDIETFSPAPLAKTGVYPYAEHPDFRLLIFGYSIDGGPVEVVDLASGGGLPDEVLAALVDPGVVK |
| A0A1G5G9L2 | 1-70 | None |
| B3WYJ2 | 1-72 | None |
| A0A1H3XAV6 | 1-70 | None |
| A0A249DX47 | 1-69 | None |
| A0A174FHK7 | 21-87 | None |
| A0A6I2J080 | 8-74 | None |
| A0A6I1MQ40 | 1-70 | None |
| A0A345CZ15 | 8-75 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.