DPCstruct | MC22755
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 130 ± 15 aa |
| Standard deviation of domain lengths | 15.36 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 32.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0318- PF14715 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6L3ZZD1 | 4-157 | HKRIDEVTGTVTSGHEWDGIEELDTPMPRWWLWSLYATIVWGIVYVILYPAWPMIHGATEGVLGWSSRGQLEAEMQADAARRAPVMN… |
| A0A1H8HJ34 | 3-153 | VKAHDPLTGHRTTGHEWDGITEWTTCVPRSVWVFIVVTRLLALVLWILLPAWPLGATHTRGLLGVDQRDAVADDIALATLARADWMQ… |
| A0A6L5C6R5 | 41-172 | None |
| A0A3B1BLK5 | 96-203 | None |
| A0A0M5KV53 | 40-185 | None |
| A0A2N3BQG3 | 7-127 | None |
| A0A017HPI2 | 2-142 | None |
| A0A4R1M2M0 | 82-190 | None |
| A0A7Y3HRU7 | 40-147 | None |
| A0A090SXW9 | 41-167 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.