DPCstruct | MC2275
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 200 ± 43 aa |
| Standard deviation of domain lengths | 43.14 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 76.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 43.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V7QTV1 | 1-171 | MKLAYLIEHDSDRAEFLKLCKRVEYTIRAWYLLHFEDLMQLYSLFDPVYGAQRLEQQSLSSEEIDVLEQNFLTYFFEVMEKSNFNIV… |
| K7MHF3 | 2-134 | MQLYSLFDPVSGAQKLEQQKLPREEIDVLEQNFLTYLFEVMKKSNFKIATQEEIDIALSGQYILNLPITVNESKLDKVLLKNYFEAH… |
| A0A287MF24 | 3-233 | None |
| A0A6N2MA62 | 16-222 | None |
| A0A0M0K0X4 | 112-299 | None |
| A0A0E0JT61 | 24-233 | None |
| A0A1D6G502 | 2-229 | None |
| A0A1D6G501 | 5-145 | None |
| A0A7S0YI09 | 28-269 | None |
| A0A7J7BUS2 | 9-218 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.