DPCstruct | MC22747
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 53 ± 3 aa |
| Standard deviation of domain lengths | 2.91 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 93.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 69.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A379RYE2 | 1-54 | MTRVNMIKGLGPVLQIAEGWSVELPKAMHDQLDARTNSTWPTTWFAPRLTGKGP |
| A0A379BFH2 | 298-352 | HRLNLIKGIGPVLQIAEGWSIDLPEQVHDILNKRTNETWPTTWFVPRLTGKGAFT |
| A0A4P0YER7 | 29-77 | None |
| A0A1V5RB86 | 4-55 | None |
| A0A485C585 | 1-54 | None |
| A0A378AHE9 | 48-95 | None |
| A0A377Z6P9 | 102-159 | None |
| A0A838TRK3 | 67-119 | None |
| A0A373PT84 | 43-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.