DPCstruct | MC22746
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 295 ± 18 aa |
| Standard deviation of domain lengths | 18.34 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 83.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 27.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R8A3K5 | 192-449 | VAILVPDKANEVELQSAVYALSGYTKKNEADGATIPISPFSDSASKDLPYTIMVAEYKNLPAEYQSKIDAEKVKKDAVIQLFKTENK… |
| A0A379RVP6 | 1-309 | MLAVNNDLSHFPVPFFDPRDNRPVTLPMVFADVPDLAQQQAASIVASWFGSRAGWRGQRFPVLYNHLPDRNAIVFATNDRRPDFLRD… |
| A0A7D5KWE9 | 207-513 | None |
| A0A0N1F9E8 | 468-766 | None |
| P0CW87 | 965-1270 | None |
| A0A1Y4E035 | 304-561 | None |
| B1H9R9 | 404-706 | None |
| A0A124FRK0 | 311-604 | None |
| A0A3P8M0Q9 | 78-377 | None |
| A0A0N1FBR6 | 954-1253 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.