DPCstruct | MC22745
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 131 ± 9 aa |
| Standard deviation of domain lengths | 9.25 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 41.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X4WTF8 | 15-145 | MRTWLRIEFLIQQLSINLPIADHAGALHFFRNISDLLDVFERGEVRTELLKELERQQRKLQAWVEVPGVDQDRIEALRQQLKSAGSV… |
| A0A7C5GRR9 | 16-146 | RAFLRLELLFRQARHFAAEPAPWCSRAALDTLHQILELLGRADLKTELIKEMERHTATLEGLRDKKGVDGARLEAILSELDRLQDHL… |
| A0A328TVK2 | 2-126 | None |
| A0A376ZP61 | 162-291 | None |
| A0A7R9AIB6 | 19-149 | None |
| A0A7C3D2K5 | 49-176 | None |
| A0A447TMC0 | 1-123 | None |
| T1HA00 | 207-331 | None |
| A0A2Z6IMH2 | 1-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.