DPCstruct | MC22744
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 223 ± 30 aa |
| Standard deviation of domain lengths | 29.86 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 23.62 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | PF16989- PF06812 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0H3JFF5 | 3-162 | QPSAPAPQIAIDSHDDKAWRDTLLKVAAILCERQPDSPQGYRLRRHALWQSITSTPQAESDGRTPLAAVSADMVADYQSRLASADMA… |
| A0A2X4WJF9 | 1-210 | MQGFVPRLKNRLARSGGMEALVPQNSSTQEHGREAAHSDSPQLSAVKSGRDLLDQAKLLSRWLSEQPQGWLASHRLIKTVRWDTVDQ… |
| A0A2V9ZJL9 | 247-434 | None |
| A0A824EST3 | 16-240 | None |
| A0A368E590 | 252-448 | None |
| A0A447XA48 | 376-627 | None |
| A0A447X861 | 16-237 | None |
| A0A3C0PDM3 | 125-345 | None |
| A0A8A8CHL5 | 136-370 | None |
| A0A444J4E6 | 38-219 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.