DPCstruct | MC22741
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 255 ± 66 aa |
| Standard deviation of domain lengths | 66.46 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 83.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.69 |
| Mean length-normalized TM-Score | 0.30 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 24.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05662 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A378MWM5 | 3-176 | SSTDAINGSQLYAAYTEIDGLNTKVNELSNGALTFVDDAGTEIVRKLGTSLNVKGGADATILTDNNIGVVATDANTLTVKLAKDIDL… |
| A0A2X4TNW4 | 38-241 | LDKDSGKISGLADGALAPDSRDAVTGSQLFSTNKNVSTNSQNIAANKAQIDSGLNFAGNTGTFNRRLGETTTIRGGLAADAAASNKN… |
| G9YIG4 | 3-359 | None |
| A0A1V4GSF0 | 83-289 | None |
| A0A377JJZ5 | 452-680 | None |
| A0A2Z4RGP4 | 78-338 | None |
| A0A1N7FDM5 | 380-767 | None |
| A0A4V3RLU2 | 72-226 | None |
| A0A5E6PY31 | 251-576 | None |
| A0A1F1GRQ4 | 83-292 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.