DPCstruct | MC22740
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 131 ± 13 aa |
| Standard deviation of domain lengths | 12.97 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 44.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16989 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0H3JFF5 | 1-119 | MTQPSAPAPQIAIDSHDDKAWRDTLLKVAAILCERQPDSPQGYRLRRHALWQSITSTPQAESDGRTPLAAVSADMVADYQSRLASAD… |
| A0A2X4TL43 | 1-121 | MVQQNVPVISVESHDEKSWRETLLKVAGILCERQPDHPQGYRLRRHAIWQNITVAPQAENDGRTPLAAFSADIMADYQTRESSADRA… |
| A0A6N8KAY9 | 1-141 | None |
| A0A8A8CHL5 | 203-343 | None |
| A0A447XA48 | 462-600 | None |
| A0A6M1CPP0 | 62-166 | None |
| A0A825UMR3 | 150-289 | None |
| A0A090RPF2 | 195-334 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.