DPCstruct | MC22738
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 53 ± 4 aa |
| Standard deviation of domain lengths | 3.75 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 94.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 72.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I1IQB6 | 55-108 | RNLLEAGLLHNDVTTVAGKGLQHYTKEPKLIDGKLTWVDGVVQSLDDKVLRSID |
| A0A2X4T8K0 | 1-54 | MRELLNAGLLHEDVNTVAGFGLKRYTLEPWLNNGELDWREGAERSLDNDVIASF |
| A0A0H3GRZ4 | 1-54 | None |
| A0A376FAR3 | 22-70 | None |
| A0A5S9I7R0 | 6-62 | None |
| A0A378AA27 | 225-278 | None |
| A0A6N6XDK9 | 19-72 | None |
| A0A2X3EF00 | 30-83 | None |
| A0A3S4KT10 | 26-68 | None |
| A0A2X3H9S6 | 50-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.