DPCstruct | MC22737
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 85 ± 6 aa |
| Standard deviation of domain lengths | 6.02 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 94.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 67.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07882 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A379ZV38 | 123-205 | AMCIRDMMQGNSKLADIGRVEESLGYNAIAAGFQGQRHWTDQYPNGDTAEAILNSSFDWNGVREPFVVATENDSLNGVAMLMG |
| A0A2X4T2E1 | 8-84 | MAMCIRDMMQGNKTLADKGLVEESLGYNAIAAGFQGQRHWTDQYPNGDTAEALLNSSFDWNGVREPFVVATENDSLN |
| A0A377CXM2 | 2-85 | None |
| A0A1V4HNA5 | 1-96 | None |
| A0A7X8EE10 | 18-104 | None |
| A0A447W5X9 | 205-287 | None |
| A0A3A6JKB1 | 269-345 | None |
| A0A1V5GU42 | 59-153 | None |
| A0A7U9XMI1 | 215-293 | None |
| A0A379BFH2 | 108-191 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.