DPCstruct | MC22736
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 318 ± 82 aa |
| Standard deviation of domain lengths | 81.80 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 76.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 16.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12736 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7I8VJU9 | 1-209 | MELRRIVAKKQLPVVCKISTIYDRSLGEGEQEFIEEGSLFVLHCLKRERRAKVLGDFNEQFYISFNCSEEVELLPSDARLDDVEFNN… |
| A0A401Q3U8 | 183-482 | QKDITFIKPLSLSDIVNQPHEKFPMLVKILEAPEQQPPFKGEWFHSLRKGTVLKIYKKQLLKKVLATSMLNKVSRHFLISTTYKGTF… |
| A0A067RIL2 | 44-568 | None |
| A0A7D9HAL9 | 9-371 | None |
| A0A1X7U205 | 9-389 | None |
| A0A7M5X9R9 | 3-368 | None |
| A0A668S6W7 | 4-222 | None |
| A0A6S7FDX1 | 3-356 | None |
| A0A6S7FMP7 | 9-354 | None |
| A0A6S7GC49 | 16-350 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.