DPCstruct | MC22735
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 144 ± 16 aa |
| Standard deviation of domain lengths | 15.92 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 44.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00795 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A401Q3I7 | 16-145 | MEAAELNSMEECLEEHLPQEQLRQLRRIMYGKELRKLDVLKSAVEGSMEKDFQLKAFGFEASHEQLRQPRVVRVGLIQNKIVLPTDS… |
| A0A0G4EVK9 | 44-192 | SLEDVFEQHIPEKERTQVMRVLYGKGRGALEVADDVVELADANNFQVKLESMVNLTAQEEMRAPRVVRIAVVQNSIALPTTDPISEQ… |
| C4WXI6 | 4-147 | None |
| G0QP75 | 544-696 | None |
| A0A7J5YMP0 | 71-219 | None |
| A0A368FU61 | 3-155 | None |
| A0A7T8KBR3 | 1-130 | None |
| A0A2J8IZM3 | 1-154 | None |
| A0A5E4CEJ7 | 1-99 | None |
| A0A6V7PWQ9 | 76-235 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.